PRKACA antibody (N-Term)
-
- Target See all PRKACA Antibodies
- PRKACA (Protein Kinase A, alpha (PRKACA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKACA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKACA antibody was raised against the N terminal of PRKACA
- Purification
- Affinity purified
- Immunogen
- PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV
- Top Product
- Discover our top product PRKACA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKACA Blocking Peptide, catalog no. 33R-5754, is also available for use as a blocking control in assays to test for specificity of this PRKACA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKACA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKACA (Protein Kinase A, alpha (PRKACA))
- Alternative Name
- PRKACA (PRKACA Products)
- Synonyms
- PKACA antibody, Calpha antibody, Cs-PKA antibody, PKCA1 antibody, PKA antibody, PKCD antibody, Pkaca antibody, zgc:158799 antibody, protein kinase cAMP-activated catalytic subunit alpha antibody, protein kinase, cAMP dependent, catalytic, alpha antibody, cAMP-dependent protein kinase catalytic subunit antibody, protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a antibody, PRKACA antibody, Prkaca antibody, kin-1 antibody, prkacaa antibody
- Background
- CAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, Hedgehog Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Carbohydrate Homeostasis, Myometrial Relaxation and Contraction, M Phase, G-protein mediated Events, Signaling Events mediated by VEGFR1 and VEGFR2, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGFR1 Specific Signals, Lipid Metabolism, SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection
-