OST alpha antibody (Middle Region)
-
- Target See all OST alpha (OSTALPHA) Antibodies
- OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OST alpha antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OSTalpha antibody was raised against the middle region of OSTalpha
- Purification
- Affinity purified
- Immunogen
- OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
- Top Product
- Discover our top product OSTALPHA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OSTalpha Blocking Peptide, catalog no. 33R-5169, is also available for use as a blocking control in assays to test for specificity of this OSTalpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSTalpha antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))
- Alternative Name
- OSTalpha (OSTALPHA Products)
- Synonyms
- Osta antibody, Ostalpha antibody, RGD1311100 antibody, OSTA antibody, OSTalpha antibody, AV001382 antibody, AW261577 antibody, D630035O19Rik antibody, OSTALPHA antibody, solute carrier family 51, alpha subunit antibody, solute carrier family 51 alpha subunit antibody, Slc51a antibody, SLC51A antibody
- Background
- OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. OSTalpha efficiently transports the major species of bile acids.
- Molecular Weight
- 38 kDa (MW of target protein)
-