FHIT antibody (Middle Region)
-
- Target See all FHIT Antibodies
- FHIT (Fragile Histidine Triad (FHIT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FHIT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FHIT antibody was raised against the middle region of FHIT
- Purification
- Affinity purified
- Immunogen
- FHIT antibody was raised using the middle region of FHIT corresponding to a region with amino acids VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF
- Top Product
- Discover our top product FHIT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FHIT Blocking Peptide, catalog no. 33R-9585, is also available for use as a blocking control in assays to test for specificity of this FHIT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FHIT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FHIT (Fragile Histidine Triad (FHIT))
- Alternative Name
- FHIT (FHIT Products)
- Synonyms
- AP3Aase antibody, FRA3B antibody, FHIT antibody, zgc:73176 antibody, AW045638 antibody, Fra14A2 antibody, LOC100223655 antibody, fragile histidine triad antibody, fragile histidine triad gene antibody, fragile histidine triad protein antibody, fragile histidine triad L homeolog antibody, FHIT antibody, Fhit antibody, fhit antibody, PY07476 antibody, fhit.L antibody
- Background
- This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.
- Molecular Weight
- 17 kDa (MW of target protein)
-