SERPINB4 antibody

Catalog No. ABIN633159

Product Details anti-SERPINB4 Antibody

Target: SERPINB4 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 4 (SERPINB4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPINB4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SERPINB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINB4 Blocking Peptide, catalog no. 33R-9275, is also available for use as a blocking control in assays to test for specificity of this SERPINB4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPINB4

Target: SERPINB4 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 4 (SERPINB4))

Alternative Name: SERPINB4 (SERPINB4 Products)

Synonyms: LEUPIN antibody, PI11 antibody, SCCA-2 antibody, SCCA1 antibody, SCCA2 antibody, serpinb4 antibody, serpin family B member 4 antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 4 L homeolog antibody, SERPINB4 antibody, serpinb4.L antibody

Background: SERPINB4 may act as a protease inhibitor to modulate the host immune response against tumor cells.

Molecular Weight: 45 kDa (MW of target protein)