CRNN antibody (Middle Region)
-
- Target See all CRNN Antibodies
- CRNN (Cornulin (CRNN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRNN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cornulin antibody was raised against the middle region of CRNN
- Purification
- Affinity purified
- Immunogen
- Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
- Top Product
- Discover our top product CRNN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cornulin Blocking Peptide, catalog no. 33R-3210, is also available for use as a blocking control in assays to test for specificity of this Cornulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRNN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRNN (Cornulin (CRNN))
- Alternative Name
- Cornulin (CRNN Products)
- Synonyms
- C1orf10 antibody, DRC1 antibody, PDRC1 antibody, SEP53 antibody, RGD1311778 antibody, Gm1015 antibody, cornulin antibody, CRNN antibody, Crnn antibody, LOC100359146 antibody
- Background
- This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
- Molecular Weight
- 52 kDa (MW of target protein)
-