NRBF2 antibody (N-Term)

Catalog No. ABIN633155

Product Details anti-NRBF2 Antibody

Target: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NRBF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NRBF2 antibody was raised against the N terminal of NRBF2

Purification: Affinity purified

Immunogen: NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRBF2 Blocking Peptide, catalog no. 33R-4448, is also available for use as a blocking control in assays to test for specificity of this NRBF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRBF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NRBF2

Target: NRBF2 (Nuclear Receptor Binding Factor 2 (NRBF2))

Alternative Name: NRBF2 (NRBF2 Products)

Synonyms: COPR1 antibody, COPR2 antibody, NRBF-2 antibody, nuclear receptor binding factor 2 antibody, NRBF2 antibody, Nrbf2 antibody

Background: NRBF2 may modulate transcriptional activation by target nuclear receptors.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway