SH3KBP1 antibody (N-Term)

Catalog No. ABIN633146

Product Details anti-SH3KBP1 Antibody

Target: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SH3KBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SH3 KBP1 antibody was raised against the N terminal of SH3 BP1

Purification: Affinity purified

Immunogen: SH3 KBP1 antibody was raised using the N terminal of SH3 BP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SH3KBP1 Blocking Peptide, catalog no. 33R-9090, is also available for use as a blocking control in assays to test for specificity of this SH3KBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 BP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SH3KBP1

Target: SH3KBP1 (SH3-Domain Kinase Binding Protein 1 (SH3KBP1))

Alternative Name: SH3KBP1 (SH3KBP1 Products)

Background: This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, EGFR Downregulation