GLIPR1L1 antibody (Middle Region)

Catalog No. ABIN633140

Product Details anti-GLIPR1L1 Antibody

Target: GLIPR1L1 (GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLIPR1L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLIPR1 L1 antibody was raised against the middle region of GLIPR1 1

Purification: Affinity purified

Immunogen: GLIPR1 L1 antibody was raised using the middle region of GLIPR1 1 corresponding to a region with amino acids NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLIPR1L1 Blocking Peptide, catalog no. 33R-6798, is also available for use as a blocking control in assays to test for specificity of this GLIPR1L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLIPR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLIPR1L1

Target: GLIPR1L1 (GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1))

Alternative Name: GLIPR1L1 (GLIPR1L1 Products)

Synonyms: 1700011E04Rik antibody, ALKN2972 antibody, PRO7434 antibody, GLI pathogenesis-related 1 like 1 antibody, GLI pathogenesis related 1 like 1 antibody, Glipr1l1 antibody, GLIPR1L1 antibody

Background: GLIPR1L1 is a novel testis-specific CAP protein and is presented to the acrosomal cap following in vitro capacitation.

Molecular Weight: 26 kDa (MW of target protein)