NT5DC2 antibody (N-Term)

Catalog No. ABIN633138

Product Details anti-NT5DC2 Antibody

Target: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NT5DC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NT5 DC2 antibody was raised against the N terminal of NT5 C2

Purification: Affinity purified

Immunogen: NT5 DC2 antibody was raised using the N terminal of NT5 C2 corresponding to a region with amino acids IRKYDYNPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NT5DC2 Blocking Peptide, catalog no. 33R-4135, is also available for use as a blocking control in assays to test for specificity of this NT5DC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NT5DC2

Target: NT5DC2 (5'-Nucleotidase Domain Containing 2 (NT5DC2))

Alternative Name: NT5DC2 (NT5DC2 Products)

Synonyms: 2510015F01Rik antibody, RGD1305524 antibody, MGC83840 antibody, im:6907673 antibody, wu:fb83e03 antibody, wu:fe11h11 antibody, zgc:153357 antibody, 5'-nucleotidase domain containing 2 antibody, 5'-nucleotidase domain containing 2 b antibody, NT5DC2 antibody, Nt5dc2 antibody, nt5dc2.S antibody, nt5dc2 antibody, nt5dc2-b antibody

Background: The NT5DC2 protein may be involved in hydrolase activity and metal ion binding.

Molecular Weight: 61 kDa (MW of target protein)