MEIOB antibody (Middle Region)

Catalog No. ABIN633134

Product Details anti-MEIOB Antibody

Target: MEIOB (Meiosis Specific with OB Domains (MEIOB))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MEIOB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C16 orf73 antibody was raised against the middle region of C16 rf73

Purification: Affinity purified

Immunogen: C16 orf73 antibody was raised using the middle region of C16 rf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C16orf73 Blocking Peptide, catalog no. 33R-1811, is also available for use as a blocking control in assays to test for specificity of this C16orf73 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf73 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MEIOB

Target: MEIOB (Meiosis Specific with OB Domains (MEIOB))

Alternative Name: C16orf73 (MEIOB Products)

Synonyms: C16orf73 antibody, gs129 antibody, 4930528F23Rik antibody, MLZ-675 antibody, meiosis specific with OB domains antibody, MEIOB antibody, Meiob antibody

Background: C16orf73 may be involved in early meiosis.

Molecular Weight: 22 kDa (MW of target protein)