TMEM139 antibody (N-Term)

Catalog No. ABIN633124

Product Details anti-TMEM139 Antibody

Target: TMEM139 (Transmembrane Protein 139 (TMEM139))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM139 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM139 antibody was raised against the N terminal of TMEM139

Purification: Affinity purified

Immunogen: TMEM139 antibody was raised using the N terminal of TMEM139 corresponding to a region with amino acids ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM139 Blocking Peptide, catalog no. 33R-4186, is also available for use as a blocking control in assays to test for specificity of this TMEM139 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM139 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM139

Target: TMEM139 (Transmembrane Protein 139 (TMEM139))

Alternative Name: TMEM139 (TMEM139 Products)

Synonyms: A930027H06Rik antibody, transmembrane protein 139 antibody, TMEM139 antibody, Tmem139 antibody

Background: The function of TMEM139 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 24 kDa (MW of target protein)