EFCAB3 antibody (N-Term)

Catalog No. ABIN633117

Product Details anti-EFCAB3 Antibody

Target: EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EFCAB3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EFCAB3 antibody was raised against the N terminal of EFCAB3

Purification: Affinity purified

Immunogen: EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EFCAB3 Blocking Peptide, catalog no. 33R-5801, is also available for use as a blocking control in assays to test for specificity of this EFCAB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFCAB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EFCAB3

Target: EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))

Alternative Name: EFCAB3 (EFCAB3 Products)

Synonyms: 4921510J17Rik antibody, RGD1305423 antibody, EF-hand calcium binding domain 3 antibody, EFCAB3 antibody, Efcab3 antibody

Background: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 50 kDa (MW of target protein)