C19orf18 antibody (N-Term)
-
- Target See all C19orf18 products
- C19orf18 (Chromosome 19 Open Reading Frame 18 (C19orf18))
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C19orf18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C19 orf18 antibody was raised against the N terminal of C19 rf18
- Purification
- Affinity purified
- Immunogen
- C19 orf18 antibody was raised using the N terminal of C19 rf18 corresponding to a region with amino acids NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C19orf18 Blocking Peptide, catalog no. 33R-6735, is also available for use as a blocking control in assays to test for specificity of this C19orf18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C19orf18 (Chromosome 19 Open Reading Frame 18 (C19orf18))
- Alternative Name
- C19orf18 (C19orf18 Products)
- Synonyms
- chromosome 19 open reading frame 18 antibody, C19orf18 antibody
- Background
- The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 24 kDa (MW of target protein)
-