ARHGEF19 antibody

Catalog No. ABIN633111

Product Details anti-ARHGEF19 Antibody

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGEF19 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGEF19 Blocking Peptide, catalog no. 33R-7904, is also available for use as a blocking control in assays to test for specificity of this ARHGEF19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGEF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGEF19

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Alternative Name: ARHGEF19 (ARHGEF19 Products)

Synonyms: WGEF antibody, 6030432F23 antibody, 6430573B13Rik antibody, Rho guanine nucleotide exchange factor 19 antibody, Rho guanine nucleotide exchange factor (GEF) 19 antibody, ARHGEF19 antibody, Arhgef19 antibody

Background: Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases.

Molecular Weight: 89 kDa (MW of target protein)