AP1m2 antibody (N-Term)

Catalog No. ABIN633108

Product Details anti-AP1m2 Antibody

Target: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AP1m2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AP1 M2 antibody was raised against the N terminal of AP1 2

Purification: Affinity purified

Immunogen: AP1 M2 antibody was raised using the N terminal of AP1 2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AP1M2 Blocking Peptide, catalog no. 33R-6400, is also available for use as a blocking control in assays to test for specificity of this AP1M2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AP1m2

Target: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Alternative Name: AP1M2 (AP1m2 Products)

Synonyms: Ap1m1 antibody, zgc:103537 antibody, D9Ertd818e antibody, [m]1B antibody, mu1B antibody, AP1-mu2 antibody, HSMU1B antibody, MU-1B antibody, MU1B antibody, mu2 antibody, adaptor-related protein complex 1, mu 2 subunit antibody, adaptor related protein complex 1 mu 2 subunit antibody, adaptor protein complex AP-1, mu 2 subunit antibody, ap1m2 antibody, AP1M2 antibody, Ap1m2 antibody

Background: This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals.

Molecular Weight: 48 kDa (MW of target protein)