Otospiralin antibody (N-Term)

Catalog No. ABIN633104

Product Details anti-Otospiralin Antibody

Target: Otospiralin (OTOS)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Otospiralin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Otospiralin antibody was raised against the N terminal of OTOS

Purification: Affinity purified

Immunogen: Otospiralin antibody was raised using the N terminal of OTOS corresponding to a region with amino acids MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Otospiralin Blocking Peptide, catalog no. 33R-6316, is also available for use as a blocking control in assays to test for specificity of this Otospiralin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTOS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Otospiralin

Target: Otospiralin (OTOS)

Alternative Name: Otospiralin (OTOS Products)

Synonyms: otosb antibody, otosp antibody, MGC85248 antibody, otos antibody, otosa antibody, MGC148549 antibody, OTOSP antibody, otospiralin L homeolog antibody, otospiralin antibody, otospiralin S homeolog antibody, otos.L antibody, OTOS antibody, otos.S antibody, otos antibody, Otos antibody

Background: OTOS may be essential for the survival of the neurosensory epithelium of the inner ear.

Molecular Weight: 10 kDa (MW of target protein)

Pathways: Sensory Perception of Sound