ATP6AP1 antibody (Middle Region)
-
- Target See all ATP6AP1 Antibodies
- ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP6AP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP6 AP1 antibody was raised against the middle region of ATP6 P1
- Purification
- Affinity purified
- Immunogen
- ATP6 AP1 antibody was raised using the middle region of ATP6 P1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
- Top Product
- Discover our top product ATP6AP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP6AP1 Blocking Peptide, catalog no. 33R-8700, is also available for use as a blocking control in assays to test for specificity of this ATP6AP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 P1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))
- Alternative Name
- ATP6AP1 (ATP6AP1 Products)
- Synonyms
- 16A antibody, ATP6IP1 antibody, ATP6S1 antibody, Ac45 antibody, CF2 antibody, VATPS1 antibody, XAP-3 antibody, XAP3 antibody, AC45 antibody, AI316502 antibody, AW108110 antibody, Atp6ip1 antibody, Atp6s1 antibody, C7-1 antibody, mFLJ00383 antibody, H+-ATPase antibody, ATPase H+ transporting accessory protein 1 antibody, ATPase, H+ transporting, lysosomal accessory protein 1 antibody, plasma membrane ATPase 4 antibody, ATP6AP1 antibody, Atp6ap1 antibody, LOC547525 antibody
- Background
- This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kDa and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Proton Transport, SARS-CoV-2 Protein Interactome
-