LRG1 antibody (N-Term)
-
- Target See all LRG1 Antibodies
- LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRG1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRG1 antibody was raised against the N terminal of LRG1
- Purification
- Affinity purified
- Immunogen
- LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
- Top Product
- Discover our top product LRG1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRG1 Blocking Peptide, catalog no. 33R-3657, is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))
- Alternative Name
- LRG1 (LRG1 Products)
- Synonyms
- lrg antibody, HMFT1766 antibody, LRG antibody, 1300008B03Rik antibody, 2310031E04Rik antibody, Lrg antibody, Lrhg antibody, si:dkey-90m5.4 antibody, leucine rich alpha-2-glycoprotein 1 antibody, leucine-rich alpha-2-glycoprotein 1 L homeolog antibody, leucine-rich alpha-2-glycoprotein 1 antibody, perilipin-5 antibody, si:dkey-90m5.4 antibody, LRG1 antibody, lrg1.L antibody, Lrg1 antibody, PLIN5 antibody
- Background
- The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.
- Molecular Weight
- 38 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-