Ensa antibody (N-Term)

Catalog No. ABIN633083

Product Details anti-Ensa Antibody

Target: Ensa (ENSA) (Endosulfine alpha (ENSA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ensa antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ENSA antibody was raised against the N terminal of ENSA

Purification: Affinity purified

Immunogen: ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENSA Blocking Peptide, catalog no. 33R-5662, is also available for use as a blocking control in assays to test for specificity of this ENSA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENSA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ensa

Target: Ensa (ENSA) (Endosulfine alpha (ENSA))

Alternative Name: ENSA (ENSA Products)

Synonyms: ARPP-19e antibody, 1700020C18Rik antibody, 2610007F17Rik antibody, AI451924 antibody, ensa antibody, si:dkeyp-24a7.3 antibody, ensaa antibody, endosulfine alpha antibody, endosulfine alpha a antibody, endosulfine alpha S homeolog antibody, ENSA antibody, Ensa antibody, ensa antibody, ensaa antibody, ensa.S antibody

Background: The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

Molecular Weight: 12 kDa (MW of target protein)