RAB11FIP2 antibody
-
- Target See all RAB11FIP2 Antibodies
- RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB11FIP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RAB11 FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF
- Top Product
- Discover our top product RAB11FIP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAB11FIP2 Blocking Peptide, catalog no. 33R-5150, is also available for use as a blocking control in assays to test for specificity of this RAB11FIP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 IP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))
- Alternative Name
- RAB11FIP2 (RAB11FIP2 Products)
- Synonyms
- RGD1308538 antibody, Rab11-FIP2 antibody, nRip11 antibody, 4930470G04Rik antibody, A830046J09Rik antibody, AW558126 antibody, Nrip11 antibody, RAB11 family interacting protein 2 antibody, RAB11 family interacting protein 2 (class I) antibody, Rab11fip2 antibody, RAB11FIP2 antibody
- Background
- RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Hormone Transport, Carbohydrate Homeostasis
-