WIPF2 antibody (Middle Region)

Catalog No. ABIN633078

Product Details anti-WIPF2 Antibody

Target: WIPF2 (WAS/WASL Interacting Protein Family, Member 2 (WIPF2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WIPF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WIPF2 antibody was raised against the middle region of WIPF2

Purification: Affinity purified

Immunogen: WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WIPF2 Blocking Peptide, catalog no. 33R-1041, is also available for use as a blocking control in assays to test for specificity of this WIPF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WIPF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WIPF2

Target: WIPF2 (WAS/WASL Interacting Protein Family, Member 2 (WIPF2))

Alternative Name: WIPF2 (WIPF2 Products)

Background: This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery.

Molecular Weight: 46 kDa (MW of target protein)