TUBB4 antibody (N-Term)

Catalog No. ABIN633077

Product Details anti-TUBB4 Antibody

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBB4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Beta Tubulin 4 antibody was raised against the N terminal of TUBB4

Purification: Affinity purified

Immunogen: Beta Tubulin 4 antibody was raised using the N terminal of TUBB4 corresponding to a region with amino acids TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Tubulin 4 Blocking Peptide, catalog no. 33R-9390, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBB4

Target: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Abstract: TUBB4A Products

Background: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Molecular Weight: 49 kDa (MW of target protein)