RABEPK antibody (N-Term)

Catalog No. ABIN633075

Product Details anti-RABEPK Antibody

Target: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RABEPK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RABEPK antibody was raised against the N terminal of RABEPK

Purification: Affinity purified

Immunogen: RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RABEPK Blocking Peptide, catalog no. 33R-6159, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RABEPK

Target: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Alternative Name: RABEPK (RABEPK Products)

Synonyms: RAB9P40 antibody, bA65N13.1 antibody, p40 antibody, 8430412M01Rik antibody, 9530020D24Rik antibody, AV073337 antibody, C87311 antibody, Rab9p40 antibody, 9530020d24rik antibody, RGD1310612 antibody, Rab9 effector protein with kelch motifs antibody, Rab9 effector protein with kelch motifs L homeolog antibody, RABEPK antibody, Rabepk antibody, rabepk.L antibody, rabepk antibody

Background: RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

Molecular Weight: 40 kDa (MW of target protein)