CPLX2 antibody (N-Term)
-
- Target See all CPLX2 Antibodies
- CPLX2 (Complexin 2 (CPLX2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPLX2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Complexin 2 antibody was raised against the N terminal of CPLX2
- Purification
- Affinity purified
- Immunogen
- Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
- Top Product
- Discover our top product CPLX2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Complexin 2 Blocking Peptide, catalog no. 33R-5832, is also available for use as a blocking control in assays to test for specificity of this Complexin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPLX2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPLX2 (Complexin 2 (CPLX2))
- Alternative Name
- Complexin 2 (CPLX2 Products)
- Background
- Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.
- Molecular Weight
- 15 kDa (MW of target protein)
- Pathways
- Synaptic Vesicle Exocytosis
-