RAB39 antibody (N-Term)

Catalog No. ABIN633072

Product Details anti-RAB39 Antibody

Target: RAB39 (RAB39, Member RAS Oncogene Family (RAB39))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB39 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB39 antibody was raised against the N terminal of RAB39

Purification: Affinity purified

Immunogen: RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB39 Blocking Peptide, catalog no. 33R-5969, is also available for use as a blocking control in assays to test for specificity of this RAB39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB39

Target: RAB39 (RAB39, Member RAS Oncogene Family (RAB39))

Alternative Name: RAB39 (RAB39 Products)

Synonyms: C230094F14Rik antibody, Rab39a antibody, RAB39, member RAS oncogene family antibody, Rab39 antibody

Background: RAB39 may be involved in vesicular trafficking.

Molecular Weight: 25 kDa (MW of target protein)