DYNC1I2 antibody (N-Term)

Catalog No. ABIN633070

Product Details anti-DYNC1I2 Antibody

Target: DYNC1I2 (Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DYNC1I2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DYNC1 I2 antibody was raised against the N terminal of DYNC1 2

Purification: Affinity purified

Immunogen: DYNC1 I2 antibody was raised using the N terminal of DYNC1 2 corresponding to a region with amino acids VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DYNC1I2 Blocking Peptide, catalog no. 33R-9431, is also available for use as a blocking control in assays to test for specificity of this DYNC1I2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DYNC1I2

Target: DYNC1I2 (Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2))

Alternative Name: DYNC1I2 (DYNC1I2 Products)

Synonyms: dnci2 antibody, dncic1 antibody, ic2 antibody, dync1i2 antibody, im:7147021 antibody, zgc:153318 antibody, 3110079H08Rik antibody, AW554389 antibody, Dncic2 antibody, Dnci2 antibody, DNCI2 antibody, IC2 antibody, dynein, cytoplasmic 1, intermediate chain 2 antibody, dynein, cytoplasmic 1, intermediate chain 2 S homeolog antibody, dynein cytoplasmic 1 intermediate chain 2 antibody, dynein, cytoplasmic 1, intermediate chain 2a antibody, dync1i2 antibody, dync1i2.S antibody, DYNC1I2 antibody, dync1i2a antibody, Dync1i2 antibody

Background: DYNC1I2 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. Involved in membrane-transport, such as Golgi apparatus, late endosomes and lysosomes.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: M Phase