EXOC8 antibody (N-Term)

Catalog No. ABIN633065

Product Details anti-EXOC8 Antibody

Target: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOC8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EXOC8 antibody was raised against the N terminal of EXOC8

Purification: Affinity purified

Immunogen: EXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOC8 Blocking Peptide, catalog no. 33R-5702, is also available for use as a blocking control in assays to test for specificity of this EXOC8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOC8

Target: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Alternative Name: EXOC8 (EXO84 Products)

Synonyms: EXOC8 antibody, zgc:162287 antibody, EXO84 antibody, Exo84p antibody, SEC84 antibody, AI414418 antibody, R74783 antibody, Exo84 antibody, exocyst complex component 8 antibody, exocyst complex component 8 S homeolog antibody, EXOC8 antibody, exoc8 antibody, Tsp_09714 antibody, Exoc8 antibody, exoc8.S antibody

Background: EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.

Molecular Weight: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism