SULT1E1 antibody (Middle Region)
-
- Target See all SULT1E1 Antibodies
- SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULT1E1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SULT1 E1 antibody was raised against the middle region of SULT1 1
- Purification
- Affinity purified
- Immunogen
- SULT1 E1 antibody was raised using the middle region of SULT1 1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY
- Top Product
- Discover our top product SULT1E1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULT1E1 Blocking Peptide, catalog no. 33R-5214, is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))
- Alternative Name
- SULT1E1 (SULT1E1 Products)
- Synonyms
- STE antibody, St1 antibody, EST antibody, ST1E1 antibody, Ste antibody, EST-1 antibody, est-1 antibody, ste antibody, sult1e1 antibody, sult1e1.S antibody, sulfotransferase family 1E member 1 antibody, sulfotransferase family 1E, estrogen-preferring, member 1 antibody, estrogen sulfotransferase antibody, sulfotransferase family 1E, member 1 antibody, sulfotransferase family 1E member 1 L homeolog antibody, Sult1e1 antibody, SULT1E1 antibody, St1 antibody, CpipJ_CPIJ012993 antibody, CpipJ_CPIJ014515 antibody, LOC482182 antibody, sult1e1.L antibody
- Background
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-