OMA1 antibody
-
- Target See all OMA1 Antibodies
- OMA1 (OMA1 Zinc Metallopeptidase Homolog (OMA1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OMA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- OMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
- Top Product
- Discover our top product OMA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OMA1 Blocking Peptide, catalog no. 33R-9932, is also available for use as a blocking control in assays to test for specificity of this OMA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OMA1 (OMA1 Zinc Metallopeptidase Homolog (OMA1))
- Alternative Name
- OMA1 (OMA1 Products)
- Synonyms
- 2010001O09Rik antibody, DAB1 antibody, MPRP-1 antibody, YKR087C antibody, ZMPOMA1 antibody, peptidase antibody, RGD1304821 antibody, oma1 antibody, OMA1 zinc metallopeptidase antibody, si:ch73-215a11.1 antibody, olfactory receptor 4K2 antibody, OMA1 antibody, Oma1 antibody, si:ch73-215a11.1 antibody, LOC531304 antibody
- Background
- OMA1 is a mitochondrial protease.
- Molecular Weight
- 60 kDa (MW of target protein)
-