UTP14A antibody
-
- Target See all UTP14A Antibodies
- UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UTP14A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UTP14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL
- Top Product
- Discover our top product UTP14A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UTP14A Blocking Peptide, catalog no. 33R-4729, is also available for use as a blocking control in assays to test for specificity of this UTP14A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UTP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))
- Alternative Name
- UTP14A (UTP14A Products)
- Synonyms
- NYCO16 antibody, SDCCAG16 antibody, dJ537K23.3 antibody, 2700066J21Rik antibody, JsdX antibody, NY-CO-16 antibody, T25628 antibody, mKIAA0266 antibody, UTP14C antibody, UTP14A antibody, utp14a antibody, UTP14A, small subunit processome component antibody, UTP14A small subunit processome component antibody, UTP14, U3 small nucleolar ribonucleoprotein, homolog A-like antibody, U3 small nucleolar RNA-associated protein 14 homolog A antibody, UTP14A, small subunit processome component L homeolog antibody, UTP14A antibody, Utp14a antibody, LOC505600 antibody, LOC100083222 antibody, utp14a.L antibody
- Background
- This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.
- Molecular Weight
- 88 kDa (MW of target protein)
-