CA5B antibody (N-Term)
-
- Target See all CA5B Antibodies
- CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CA5B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carbonic Anhydrase Vb antibody (Mitochondrial) was raised against the N terminal of CA5 B
- Purification
- Affinity purified
- Immunogen
- Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5 B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
- Top Product
- Discover our top product CA5B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carbonic Anhydrase Vb Blocking Peptide (Mitochondrial), catalog no. 33R-9998, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase Vb antibody (Mitochondrial)
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))
- Alternative Name
- Carbonic Anhydrase Vb (CA5B Products)
- Synonyms
- CA-VB antibody, 7330410H16Rik antibody, CAVB antibody, Ca5b antibody, CarVb antibody, D730005F19Rik antibody, zgc:171653 antibody, CA5B antibody, ca5b antibody, carbonic anhydrase 5B antibody, carbonic anhydrase 5b, mitochondrial antibody, carbonic anhydrase Va antibody, carbonic anhydrase 5A antibody, carbonic anhydrase 5B, mitochondrial antibody, carbonic anhydrase VB, mitochondrial L homeolog antibody, CA5B antibody, Car5b antibody, Ca5b antibody, ca5a antibody, CA5A antibody, LOC100051095 antibody, ca5b.L antibody
- Background
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles.
- Molecular Weight
- 33 kDa (MW of target protein)
-