PCGF1 antibody (Middle Region)
-
- Target See all PCGF1 Antibodies
- PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCGF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PCGF1 antibody was raised against the middle region of PCGF1
- Purification
- Affinity purified
- Immunogen
- PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV
- Top Product
- Discover our top product PCGF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCGF1 Blocking Peptide, catalog no. 33R-6967, is also available for use as a blocking control in assays to test for specificity of this PCGF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))
- Alternative Name
- PCGF1 (PCGF1 Products)
- Synonyms
- PCGF1 antibody, 2010002K04Rik antibody, NSPC1 antibody, RNF3A-2 antibody, RNF68 antibody, AU024121 antibody, Nspc1 antibody, nspc1 antibody, si:zc207o21.2 antibody, polycomb group ring finger 1 antibody, polycomb group ring finger 1 L homeolog antibody, PCGF1 antibody, pcgf1 antibody, Pcgf1 antibody, pcgf1.L antibody
- Background
- PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.
- Molecular Weight
- 30 kDa (MW of target protein)
-