SDR16C5 antibody (Middle Region)
-
- Target See all SDR16C5 (RDHE2) Antibodies
- SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SDR16C5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RDHE2 antibody was raised against the middle region of RDHE2
- Purification
- Affinity purified
- Immunogen
- RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
- Top Product
- Discover our top product RDHE2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RDHE2 Blocking Peptide, catalog no. 33R-1208, is also available for use as a blocking control in assays to test for specificity of this RDHE2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDHE2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))
- Alternative Name
- RDHE2 (RDHE2 Products)
- Synonyms
- RDH2 antibody, RDH-E2 antibody, RDHE2 antibody, Rdhe2 antibody, Scdr9 antibody, RGD1565999 antibody, rdhe2 antibody, sdr16c5 antibody, short chain dehydrogenase/reductase family 16C member 5 antibody, short chain dehydrogenase/reductase family 16C, member 5 antibody, short chain dehydrogenase/reductase family 16C member 5 L homeolog antibody, SDR16C5 antibody, Sdr16c5 antibody, sdr16c5.L antibody
- Background
- The specific function of RDHE2 is not yet known.
- Molecular Weight
- 34 kDa (MW of target protein)
-