SFRS12 antibody (N-Term)

Catalog No. ABIN633011

Product Details anti-SFRS12 Antibody

Target: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFRS12 antibody was raised against the N terminal of SFRS12

Purification: Affinity purified

Immunogen: SFRS12 antibody was raised using the N terminal of SFRS12 corresponding to a region with amino acids DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS12 Blocking Peptide, catalog no. 33R-2117, is also available for use as a blocking control in assays to test for specificity of this SFRS12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS12

Target: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Alternative Name: SFRS12 (SREK1 Products)

Synonyms: SFRS12 antibody, SRrp508 antibody, SRrp86 antibody, Sfrs12 antibody, Srrp86 antibody, Srsf12 antibody, 8430401B01 antibody, AI450757 antibody, AI462342 antibody, zgc:100974 antibody, splicing regulatory glutamic acid and lysine rich protein 1 antibody, splicing regulatory glutamine/lysine-rich protein 1 antibody, SREK1 antibody, Srek1 antibody, srek1 antibody

Background: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.

Molecular Weight: 72 kDa (MW of target protein)