C6orf154 antibody (N-Term)
-
- Target See all C6orf154 products
- C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C6orf154 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C6 orf154 antibody was raised against the N terminal of C6 rf154
- Purification
- Affinity purified
- Immunogen
- C6 orf154 antibody was raised using the N terminal of C6 rf154 corresponding to a region with amino acids MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C6orf154 Blocking Peptide, catalog no. 33R-6203, is also available for use as a blocking control in assays to test for specificity of this C6orf154 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf154 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))
- Alternative Name
- C6orf154 (C6orf154 Products)
- Synonyms
- C6orf154 antibody, LRRC73 antibody, nod3l antibody, leucine rich repeat containing 73 antibody, LRRC73 antibody, Lrrc73 antibody
- Background
- The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 33 kDa (MW of target protein)
-