LYSMD2 antibody (Middle Region)

Catalog No. ABIN632998

Product Details anti-LYSMD2 Antibody

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYSMD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYSMD2 antibody was raised against the middle region of LYSMD2

Purification: Affinity purified

Immunogen: LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYSMD2 Blocking Peptide, catalog no. 33R-9496, is also available for use as a blocking control in assays to test for specificity of this LYSMD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYSMD2

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Alternative Name: LYSMD2 (LYSMD2 Products)

Synonyms: 2210402C18Rik antibody, AV033872 antibody, AW538442 antibody, RGD1304585 antibody, zgc:91941 antibody, MGC108236 antibody, LysM, putative peptidoglycan-binding, domain containing 2 antibody, LysM domain containing 2 antibody, LysM, putative peptidoglycan-binding, domain containing 2 L homeolog antibody, Lysmd2 antibody, LYSMD2 antibody, lysmd2.L antibody, lysmd2 antibody

Background: The function of LYSMD2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 23 kDa (MW of target protein)