PIK3R5 antibody (N-Term)

Catalog No. ABIN632989

Product Details anti-PIK3R5 Antibody

Target: PIK3R5 (Phosphoinositide-3-Kinase, Regulatory Subunit 5 (PIK3R5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIK3R5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIK3 R5 antibody was raised against the N terminal of PIK3 5

Purification: Affinity purified

Immunogen: PIK3 R5 antibody was raised using the N terminal of PIK3 5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIK3R5 Blocking Peptide, catalog no. 33R-3839, is also available for use as a blocking control in assays to test for specificity of this PIK3R5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIK3R5

Target: PIK3R5 (Phosphoinositide-3-Kinase, Regulatory Subunit 5 (PIK3R5))

Alternative Name: PIK3R5 (PIK3R5 Products)

Synonyms: F730038I15Rik antibody, FOAP-2 antibody, P101-PI3K antibody, p101 antibody, P101 antibody, RGD1563261 antibody, AV230647 antibody, phosphoinositide-3-kinase regulatory subunit 5 antibody, phosphoinositide-3-kinase regulatory subunit 5 S homeolog antibody, phosphoinositide-3-kinase, regulatory subunit 5 antibody, PIK3R5 antibody, pik3r5.S antibody, Pik3r5 antibody

Background: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: PI3K-Akt Signaling, Inositol Metabolic Process, Hepatitis C, VEGF Signaling