C15orf26/CFAP161 antibody (C-Term)
-
- Target See all C15orf26/CFAP161 (C15orf26) products
- C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C15orf26/CFAP161 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C15 ORF26 antibody was raised against the C terminal Of C15 rf26
- Purification
- Affinity purified
- Immunogen
- C15 ORF26 antibody was raised using the C terminal Of C15 rf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C15ORF26 Blocking Peptide, catalog no. 33R-5056, is also available for use as a blocking control in assays to test for specificity of this C15ORF26 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF26 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))
- Alternative Name
- C15ORF26 (C15orf26 Products)
- Synonyms
- 1700026D08Rik antibody, AW047638 antibody, AW551802 antibody, C21H15orf26 antibody, cilia and flagella associated protein 161 antibody, cilia and flagella associated protein 161 L homeolog antibody, CFAP161 antibody, cfap161.L antibody, cfap161 antibody, Cfap161 antibody
- Background
- The function of C15orf26 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 34 kDa (MW of target protein)
-