USP18 antibody (N-Term)

Catalog No. ABIN632980

Product Details anti-USP18 Antibody

Target: USP18 (Ubiquitin Specific Peptidase 18 (USP18))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: USP18 antibody was raised against the N terminal of USP18

Purification: Affinity purified

Immunogen: USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP18 Blocking Peptide, catalog no. 33R-6322, is also available for use as a blocking control in assays to test for specificity of this USP18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP18

Target: USP18 (Ubiquitin Specific Peptidase 18 (USP18))

Alternative Name: USP18 (USP18 Products)

Synonyms: ISG43 antibody, UBP43 antibody, bubp43 antibody, 1110058H21Rik antibody, AW047653 antibody, Ubp15 antibody, UBP antibody, USP18 antibody, USP41 antibody, ubiquitin specific peptidase 18 antibody, USP18 antibody, Usp18 antibody

Background: USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.

Molecular Weight: 43 kDa (MW of target protein)