RFESD antibody

Catalog No. ABIN632977

Product Details anti-RFESD Antibody

Target: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFESD antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFESD Blocking Peptide, catalog no. 33R-9881, is also available for use as a blocking control in assays to test for specificity of this RFESD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFESD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFESD

Target: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Alternative Name: RFESD (RFESD Products)

Synonyms: MGC82457 antibody, zgc:112118 antibody, AI256775 antibody, D030068K09 antibody, RGD1308284 antibody, Rieske Fe-S domain containing antibody, Rieske (Fe-S) domain containing L homeolog antibody, Rieske (Fe-S) domain containing antibody, RFESD antibody, rfesd.L antibody, rfesd antibody, Rfesd antibody

Background: The function of RFESD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 18 kDa (MW of target protein)