DIP2A antibody
-
- Target See all DIP2A Antibodies
- DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DIP2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DIP2 A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL
- Top Product
- Discover our top product DIP2A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DIP2A Blocking Peptide, catalog no. 33R-7196, is also available for use as a blocking control in assays to test for specificity of this DIP2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))
- Alternative Name
- DIP2A (DIP2A Products)
- Synonyms
- C21orf106 antibody, Dip2-like antibody, DIP2 antibody, 4931420H10Rik antibody, AI426328 antibody, Dip2 antibody, Kiaa0184-hp antibody, mKIAA0184 antibody, disco-interacting protein 2 homolog A antibody, disco interacting protein 2 homolog A antibody, Dip2a antibody, DIP2A antibody
- Background
- The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 170 kDa (MW of target protein)
- Pathways
- M Phase
-