Proline Rich 18 antibody (N-Term)
-
- Target See all Proline Rich 18 (PRR18) products
- Proline Rich 18 (PRR18)
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Proline Rich 18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRR18 antibody was raised against the N terminal of PRR18
- Purification
- Affinity purified
- Immunogen
- PRR18 antibody was raised using the N terminal of PRR18 corresponding to a region with amino acids RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRR18 Blocking Peptide, catalog no. 33R-8101, is also available for use as a blocking control in assays to test for specificity of this PRR18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Proline Rich 18 (PRR18)
- Alternative Name
- PRR18 (PRR18 Products)
- Synonyms
- 9630019K15Rik antibody, proline rich 18 antibody, PRR18 antibody, Prr18 antibody
- Background
- The function of PRR18 has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 31 kDa (MW of target protein)
-