FBXO15 antibody (N-Term)
-
- Target See all FBXO15 Antibodies
- FBXO15 (F-Box Protein 15 (FBXO15))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO15 antibody was raised against the N terminal of FBXO15
- Purification
- Affinity purified
- Immunogen
- FBXO15 antibody was raised using the N terminal of FBXO15 corresponding to a region with amino acids QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL
- Top Product
- Discover our top product FBXO15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO15 Blocking Peptide, catalog no. 33R-7503, is also available for use as a blocking control in assays to test for specificity of this FBXO15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO15 (F-Box Protein 15 (FBXO15))
- Alternative Name
- FBXO15 (FBXO15 Products)
- Background
- FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
- Molecular Weight
- 49 kDa (MW of target protein)
-