TBC1D13 antibody (Middle Region)
-
- Target See all TBC1D13 Antibodies
- TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TBC1D13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TBC1 D13 antibody was raised against the middle region of TBC1 13
- Purification
- Affinity purified
- Immunogen
- TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS
- Top Product
- Discover our top product TBC1D13 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TBC1D13 Blocking Peptide, catalog no. 33R-2969, is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))
- Alternative Name
- TBC1D13 (TBC1D13 Products)
- Synonyms
- 2600014A06Rik antibody, BC025586 antibody, TBC1 domain family member 13 antibody, TBC1 domain family, member 13 antibody, TBC1D13 antibody, Tbc1d13 antibody
- Background
- TBC1D13 may act as a GTPase-activating protein for Rab family proteins.
- Molecular Weight
- 44 kDa (MW of target protein)
-