SCRN2 antibody (N-Term)
-
- Target See all SCRN2 Antibodies
- SCRN2 (Secernin 2 (SCRN2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCRN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Secernin 2 antibody was raised against the N terminal of SCRN2
- Purification
- Affinity purified
- Immunogen
- Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT
- Top Product
- Discover our top product SCRN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Secernin 2 Blocking Peptide, catalog no. 33R-5762, is also available for use as a blocking control in assays to test for specificity of this Secernin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCRN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCRN2 (Secernin 2 (SCRN2))
- Alternative Name
- Secernin 2 (SCRN2 Products)
- Synonyms
- MGC147610 antibody, si:ch211-184m19.2 antibody, Ses2 antibody, AV001119 antibody, D11Moh48 antibody, SES2 antibody, secernin 2 antibody, secernin 2 S homeolog antibody, SCRN2 antibody, scrn2 antibody, scrn2.S antibody, Scrn2 antibody
- Background
- The function of SCRN2 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 47 kDa (MW of target protein)
-