SCRN2 antibody (N-Term)

Catalog No. ABIN632961

Product Details anti-SCRN2 Antibody

Target: SCRN2 (Secernin 2 (SCRN2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCRN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Secernin 2 antibody was raised against the N terminal of SCRN2

Purification: Affinity purified

Immunogen: Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Secernin 2 Blocking Peptide, catalog no. 33R-5762, is also available for use as a blocking control in assays to test for specificity of this Secernin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCRN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCRN2

Target: SCRN2 (Secernin 2 (SCRN2))

Alternative Name: Secernin 2 (SCRN2 Products)

Synonyms: MGC147610 antibody, si:ch211-184m19.2 antibody, Ses2 antibody, AV001119 antibody, D11Moh48 antibody, SES2 antibody, secernin 2 antibody, secernin 2 S homeolog antibody, SCRN2 antibody, scrn2 antibody, scrn2.S antibody, Scrn2 antibody

Background: The function of SCRN2 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 47 kDa (MW of target protein)