CCDC74A antibody (Middle Region)
-
- Target See all CCDC74A products
- CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCDC74A antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- CCDC74 A antibody was raised against the middle region of CCDC74
- Purification
- Affinity purified
- Immunogen
- CCDC74 A antibody was raised using the middle region of CCDC74 corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CCDC74A Blocking Peptide, catalog no. 33R-3020, is also available for use as a blocking control in assays to test for specificity of this CCDC74A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC70 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))
- Alternative Name
- CCDC74A (CCDC74A Products)
- Background
- The function of CCDC74A protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 42 kDa (MW of target protein)
-