BTF3P13 antibody (Middle Region)

Catalog No. ABIN632957

Product Details anti-BTF3P13 Antibody

Target: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTF3P13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BTF3 L3 antibody was raised against the middle region of BTF3 3

Purification: Affinity purified

Immunogen: BTF3 L3 antibody was raised using the middle region of BTF3 3 corresponding to a region with amino acids CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTF3L3 Blocking Peptide, catalog no. 33R-1800, is also available for use as a blocking control in assays to test for specificity of this BTF3L3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTF3P13

Target: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Alternative Name: BTF3L3 (BTF3P13 Products)

Synonyms: BTF3L3 antibody, HUMBTFD antibody, basic transcription factor 3 pseudogene 13 antibody, BTF3P13 antibody

Background: BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.

Molecular Weight: 23 kDa (MW of target protein)