MAGEB1 antibody (Middle Region)

Catalog No. ABIN632955

Product Details anti-MAGEB1 Antibody

Target: MAGEB1 (Melanoma Antigen Family B, 1 (MAGEB1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEB1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAGEB1 antibody was raised against the middle region of MAGEB1

Purification: Affinity purified

Immunogen: MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEB1 Blocking Peptide, catalog no. 33R-2406, is also available for use as a blocking control in assays to test for specificity of this MAGEB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEB1

Target: MAGEB1 (Melanoma Antigen Family B, 1 (MAGEB1))

Alternative Name: MAGEB1 (MAGEB1 Products)

Synonyms: CT3.1 antibody, DAM10 antibody, MAGE-Xp antibody, MAGEL1 antibody, MAGEB1 antibody, Mage-b1 antibody, Mage-rs1 antibody, Magel1 antibody, Smage1 antibody, dam1 antibody, MAGE family member B1 antibody, melanoma-associated antigen B1 antibody, melanoma antigen, family B, 1 antibody, melanoma antigen family B, 1 antibody, MAGEB1 antibody, LOC491803 antibody, Mageb1 antibody

Background: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

Molecular Weight: 39 kDa (MW of target protein)