PDXP antibody
-
- Target See all PDXP Antibodies
- PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))
-
Reactivity
- Mouse, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDXP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
- Top Product
- Discover our top product PDXP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PDXP Blocking Peptide, catalog no. 33R-2122, is also available for use as a blocking control in assays to test for specificity of this PDXP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))
- Alternative Name
- PDXP (PDXP Products)
- Synonyms
- CIN antibody, PLP antibody, dJ37E16.5 antibody, 1600027H05Rik antibody, AB041662 antibody, PLPP antibody, Rbp1 antibody, pyridoxal phosphatase antibody, pyridoxal (pyridoxine, vitamin B6) phosphatase antibody, PDXP antibody, Pdxp antibody
- Background
- Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.
- Molecular Weight
- 32 kDa (MW of target protein)
-