SASH3 antibody (N-Term)
-
- Target See all SASH3 Antibodies
- SASH3 (SAM and SH3 Domain Containing 3 (SASH3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SASH3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CXORF9 antibody was raised against the N terminal Of Cxorf9
- Purification
- Affinity purified
- Immunogen
- CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM
- Top Product
- Discover our top product SASH3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CXORF9 Blocking Peptide, catalog no. 33R-4594, is also available for use as a blocking control in assays to test for specificity of this CXORF9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SASH3 (SAM and SH3 Domain Containing 3 (SASH3))
- Alternative Name
- CXORF9 (SASH3 Products)
- Background
- The CXORF9 protein contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.
- Molecular Weight
- 41 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response
-